NPR2L (NPRL2) Rabbit Polyclonal Antibody

CAT#: TA339702

Rabbit Polyclonal Anti-NPRL2 Antibody

Product Images

WB Suggested Anti-NPRL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate NPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3

• 

  Rabbit Anti-NPRL2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rab

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TUSC4 antibody: synthetic peptide directed towards the N terminal of human TUSC4. Synthetic peptide located within the following region: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: NPR2-like, GATOR1 complex subunit
• Database Link:
  NP_006536
  Entrez Gene 10641 Human
  UniProt ID Q8WTW4
• Background: TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs.
• Synonyms: FFEVF2; NPR2; NPR2L; TUSC4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome