PPCDC Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PPCDC antibody: synthetic peptide directed towards the N terminal of human PPCDC. Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 22 kDa |
Gene Name | phosphopantothenoylcysteine decarboxylase |
Database Link | |
Background | Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine (Daugherty et al., 2002 [PubMed 11923312]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (4) lacks two alternate in-frame exons in the central coding region, compared to variant 1, resulting in an isoform (d) that is shorter than isoform a. ##Evidence-Data-START## Transcript exon combination :: BI833814.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | coaC; MDS018; PPC-DC |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86% |
Reference Data | |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review