OXSM Rabbit Polyclonal Antibody

CAT#: TA339340

Rabbit Polyclonal Anti-OXSM Antibody

Product Images

WB Suggested Anti-OXSM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OXSM antibody: synthetic peptide directed towards the middle region of human OXSM. Synthetic peptide located within the following region: HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: 3-oxoacyl-ACP synthase, mitochondrial
• Database Link:
  NP_060367
  Entrez Gene 54995 Human
  UniProt ID Q9NWU1
• Background: This gene encodes a beta-ketoacyl synthetase. The encoded enzyme is required for elongation of fatty acid chains in the mitochondria. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
• Synonyms: FASN2D; KASI; KS
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fatty acid biosynthesis, Metabolic pathways