ZRANB2 Rabbit Polyclonal Antibody

CAT#: TA339112

Rabbit Polyclonal Anti-ZRANB2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of zinc finger, RAN-binding domain containing 2 (ZRANB2), transcript variant 1
    • 100 ug

USD 436.00

Other products for "ZRANB2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZRANB2 antibody: synthetic peptide directed towards the middle region of human ZRANB2. Synthetic peptide located within the following region: GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name zinc finger RANBP2-type containing 2
Background ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5'-splice site selection.
Synonyms ZIS; ZIS1; ZIS2; ZNF265
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.