GATD3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of chromosome 21 open reading frame 33 (C21orf33), nuclear gene encoding mitochondrial protein, transcript variant 2
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "GATD3"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C21orf33 antibody: synthetic peptide directed towards the N terminal of human C21orf33. Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 21 kDa |
Gene Name | chromosome 21 open reading frame 33 |
Database Link | |
Background | This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Synonyms | ES1; GT335; HES1; KNPH; KNPI |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Mouse: 92%; Pig: 86%; Horse: 86%; Zebrafish: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.