GATD3 Rabbit Polyclonal Antibody

CAT#: TA338921

Rabbit Polyclonal Anti-C21orf33 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG2.C21orf33 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C21orf33 antibody: synthetic peptide directed towards the N terminal of human C21orf33. Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: chromosome 21 open reading frame 33
• Database Link:
  NP_937798
  Entrez Gene 8209 Human
  UniProt ID P0DPI2
• Background: This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Synonyms: ES1; GT335; HES1; KNPH; KNPI
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Mouse: 92%; Pig: 86%; Horse: 86%; Zebrafish: 86%; Guinea pig: 86%