UBXD3 (UBXN10) Rabbit Polyclonal Antibody

CAT#: TA338832

Rabbit Polyclonal Anti-UBXN10 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of UBX domain protein 10 (UBXN10)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human UBX domain protein 10 (UBXN10), 20 µg
    • 20 ug

USD 867.00

Other products for "UBXD3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UBXD3 antibody: synthetic peptide directed towards the middle region of human UBXD3. Synthetic peptide located within the following region: PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name UBX domain protein 10
Background The function of this protein remains unknown.
Synonyms UBXD3
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.