C17orf57 (EFCAB13) Rabbit Polyclonal Antibody

CAT#: TA338825

Rabbit Polyclonal Anti-EFCAB13 Antibody

Product Images

WB Suggested Anti-EFCAB13 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf57 antibody: synthetic peptide directed towards the N terminal of human C17orf57. Synthetic peptide located within the following region: CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: EF-hand calcium binding domain 13
• Database Link:
  NP_689560
  Entrez Gene 124989 Human
  UniProt ID Q8IY85
• Background: The exact function of EFCAB13 remains unknown.
• Synonyms: C17orf57
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Bovine: 85%; Goat: 82%