KCNRG Rabbit Polyclonal Antibody

CAT#: TA338800

Rabbit Polyclonal Anti-KCNRG Antibody

Product Images

WB Suggested Anti-KCNRG Antibody Titration: 2.5 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the N terminal of human KCNRG. Synthetic peptide located within the following region: VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: potassium channel regulator
• Database Link:
  NP_775876
  Entrez Gene 283518 Human
  UniProt ID Q8N5I3
• Background: This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• Synonyms: DLTET
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Dog: 92%; Pig: 86%; Bovine: 86%; Rat: 85%