P2X5 (P2RX5) Rabbit Polyclonal Antibody

CAT#: TA338778

Rabbit Polyclonal Anti-P2RX5 Antibody

Product Images

WB Suggested Anti-P2RX5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RX5 antibody: synthetic peptide directed towards the N terminal of human P2RX5. Synthetic peptide located within the following region: LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: purinergic receptor P2X 5
• Database Link:
  NP_778256
  Entrez Gene 5026 Human
  UniProt ID Q93086
• Background: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3). [provided by RefSeq, Mar 2011]
• Synonyms: 5; ligand-gated ion channel; LRH-1; MGC47755; P2X5; P2x5; P2X5R; purinergic receptor P2X; purinergic receptor P2X5
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Bovine: 85%; Rabbit: 79%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction