KCTD12 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "KCTD12"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Kctd12 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Kctd12. Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | potassium channel tetramerization domain containing 12 |
Database Link | |
Background | Kctd12 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization. |
Synonyms | C13orf2; PFET1; PFETIN |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 91% |
Reference Data | |
Protein Families | Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.