KCTD12 Rabbit Polyclonal Antibody

CAT#: TA338730

Rabbit Polyclonal Anti-Kctd12 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "KCTD12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Kctd12 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Kctd12. Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name potassium channel tetramerization domain containing 12
Background Kctd12 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. It increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.
Synonyms C13orf2; PFET1; PFETIN
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%; Guinea pig: 91%
Reference Data
Protein Families Ion Channels: Other

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.