NRSN2 Rabbit Polyclonal Antibody

CAT#: TA338691

Rabbit Polyclonal Anti-NRSN2 Antibody

Product Images

WB Suggested Anti-NRSN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NRSN2 antibody: synthetic peptide directed towards the middle region of human NRSN2. Synthetic peptide located within the following region: LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: neurensin 2
• Database Link:
  NP_079234
  Entrez Gene 80023 Human
  UniProt ID Q9GZP1
• Background: NRSN2 may play a role in maintenance and/or transport of vesicles.
• Synonyms: C20orf98; dJ1103G7.6
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 83%

Reference Data

• Protein Families: Transmembrane