ADAM19 Rabbit Polyclonal Antibody

CAT#: TA338633

Rabbit Polyclonal Anti-ADAM19 Antibody

Product Images

WB Suggested Anti-ADAM19 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate ADAM19 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAM19 antibody: synthetic peptide directed towards the N terminal of human ADAM19. Synthetic peptide located within the following region: GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: ADAM metallopeptidase domain 19
• Database Link:
  NP_075525
  Entrez Gene 8728 Human
  UniProt ID Q9H013
• Background: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
• Synonyms: ADAM metallopeptidase domain 19; ADAM metallopeptidase domain 19 (meltrin beta); a disintegrin and metalloproteinase domain 19 (meltrin beta); FKSG34; MADDAM; meltrin beta; MLTNB
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane