FAM38B (PIEZO2) Rabbit Polyclonal Antibody

CAT#: TA338481

Rabbit Polyclonal Anti-PIEZO2 Antibody

Product Images

WB Suggested Anti-PIEZO2Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate. PIEZO2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: piezo type mechanosensitive ion channel component 2
• Database Link:
  NP_071351
  Entrez Gene 63895 Human
  UniProt ID Q9H5I5
• Background: PIEZO2is a multi-pass membrane proteinPotential. It belongs to the FAM38 family.The exact function of PIEZO2remains unknown.
• Synonyms: C18orf30; C18orf58; DA3; DA5; FAM38B; FAM38B2; HsT748; HsT771; MWKS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane