ABIN3 (TNIP3) Rabbit Polyclonal Antibody

CAT#: TA338308

Rabbit Polyclonal Anti-TNIP3 Antibody

Product Images

WB Suggested Anti-TNIP3 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNIP3 antibody is: synthetic peptide directed towards the N-terminal region of Human TNIP3. Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: TNFAIP3 interacting protein 3
• Database Link:
  NP_001122315
  Entrez Gene 79931 Human
  UniProt ID Q96KP6
• Background: TNIP3 binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.
• Synonyms: ABIN-3; LIND
• Note: Immunogen Sequence Homology: Human: 100%