ABIN3 (TNIP3) Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 436.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TNIP3 antibody is: synthetic peptide directed towards the N-terminal region of Human TNIP3. Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 27 kDa |
Gene Name | TNFAIP3 interacting protein 3 |
Database Link | |
Background | TNIP3 binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding. |
Synonyms | ABIN-3; LIND |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review