Glypican 6 (GPC6) Rabbit Polyclonal Antibody

CAT#: TA338144

Rabbit Polyclonal Anti-GPC6 Antibody

Product Images

WB Suggested Anti-GPC6 Antibody; Titration: 1.0 ug/ml; Positive Control: THP-1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPC6 antibody is: synthetic peptide directed towards the N-terminal region of Human GPC6. Synthetic peptide located within the following region: AYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFEN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: glypican 6
• Database Link:
  NP_005699
  Entrez Gene 10082 Human
  UniProt ID Q9Y625
• Background: The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases.
• Synonyms: OMIMD1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 90%; Guinea pig: 90%; Horse: 82%

Reference Data

• Protein Families: Druggable Genome