SHOC2 Rabbit Polyclonal Antibody

CAT#: TA338107

Rabbit Polyclonal Anti-SHOC2 Antibody

Product Images

Host: Rabbit; Target Name: SHOC2; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SHOC2 antibody is: synthetic peptide directed towards the N-terminal region of Human SHOC2. Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: SHOC2 leucine-rich repeat scaffold protein
• Database Link:
  NP_031399
  Entrez Gene 8036 Human
  UniProt ID Q9UQ13
• Background: This gene encodes a protein that consists almost entirely of leucine-rich repeats, a domain implicated in protein-protein interactions. The protein may function as a scaffold linking RAS to downstream signal transducers in the RAS/ERK MAP kinase signaling cascade. Mutations in this gene have been associated with Noonan-like syndrome with loose anagen hair.
• Synonyms: SIAA0862; SOC2; SUR8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome