GPR105 (P2RY14) Rabbit Polyclonal Antibody

CAT#: TA338075

Rabbit Polyclonal Anti-P2RY14 Antibody

Product Images

WB Suggested Anti-P2RY14 Antibody; Titration: 1.0 ug/ml; Positive Control: MDA-MB-435S Whole Cell P2RY14 is supported by BioGPS gene expression data to be expressed in MDA-MB435

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: purinergic receptor P2Y14
• Database Link:
  NP_055694
  Entrez Gene 9934 Human
  UniProt ID Q15391
• Background: The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor for UDP-glucose and other UDP-sugars coupled to G-proteins. It has been implicated in extending the known immune system functions of P2Y receptors by participating in the regulation of the stem cell compartment, and it may also play a role in neuroimmune function. Two transcript variants encoding the same protein have been identified for this gene.
• Synonyms: BPR105; GPR105; P2Y14
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Horse: 92%; Bovine: 92%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction