LGSN Rabbit Polyclonal Antibody

CAT#: TA338047

Rabbit Polyclonal Anti-LGSN Antibody

Product Images

WB Suggested Anti-LGSN Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LGSN antibody is: synthetic peptide directed towards the N-terminal region of Human LGSN. Synthetic peptide located within the following region: QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: lengsin, lens protein with glutamine synthetase domain
• Database Link:
  NP_057655
  Entrez Gene 51557 Human
  UniProt ID Q5TDP6
• Background: This gene encodes a protein with similarity to the GS I members of the glutamine synthetase superfamily. The encoded protein is referred to as a pseudo-glutamine synthetase because it has no glutamine synthesis activity and may function as a chaperone protein. This protein is localized to the lens and may be associated with cataract disease.
• Synonyms: GLULD1; LGS
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 85%; Rabbit: 79%