RPL36A Rabbit Polyclonal Antibody

CAT#: TA338016

Rabbit Polyclonal Anti-RPL36A Antibody

Product Images

WB Suggested Anti-RPL36A Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell RPL36A is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RPL36A antibody is: synthetic peptide directed towards the middle region of Human RPL36A. Synthetic peptide located within the following region: PHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: ribosomal protein L36a
• Database Link:
  NP_066357
  Entrez Gene 6173 Human
  UniProt ID P83881
• Background: Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which shares sequence similarity with yeast ribosomal protein L44, belongs to the L44E (L36AE) family of ribosomal proteins. Although this gene has been referred to as ribosomal protein L44 (RPL44), its official name is ribosomal protein L36a (RPL36A). This gene and the human gene officially named ribosomal protein L36a-like (RPL36AL) encode nearly identical proteins; however, they are distinct genes. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Naturally occurring read-through transcription occurs between this locus and the heterogeneous nuclear ribonucleoprotein H2 (H') gene.
• Synonyms: L36A; L44L; MIG6; RPL44
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Ribosome