C13orf30 (FAM216B) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of chromosome 13 open reading frame 30 (C13orf30)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "C13orf30"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAM216B antibody: synthetic peptide directed towards the N terminal of human FAM216B. Synthetic peptide located within the following region: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 16 kDa |
Gene Name | family with sequence similarity 216 member B |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C13orf30 |
Note | Immunogen Sequence Homology: Human: 100%; Zebrafish: 90% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.