Keratin 39 (KRT39) Rabbit Polyclonal Antibody

CAT#: TA337399

Rabbit Polyclonal Anti-KRT39 Antibody

Product Images

Host: Rabbit; Target Name: KRT39; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KRT39 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT39. Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: keratin 39
• Database Link:
  NP_998821
  Entrez Gene 390792 Human
  UniProt ID Q6A163
• Background: This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21.
• Synonyms: CK-39; K39; KA35
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%