NrCAM Rabbit Polyclonal Antibody

CAT#: TA336014

Rabbit Polyclonal Anti-NRCAM Antibody

Product Images

WB Suggested Anti-NRCAM Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NRCAM Antibody: synthetic peptide directed towards the N terminal of human NRCAM. Synthetic peptide located within the following region: PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: neuronal cell adhesion molecule
• Database Link:
  NP_001032209
  Entrez Gene 4897 Human
  UniProt ID Q92823
• Background: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
• Synonyms: KIAA0343; MGC138845; MGC138846
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)