ATG9A Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 665.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ATG9A Antibody: synthetic peptide directed towards the middle region of human ATG9A. Synthetic peptide located within the following region: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 94 kDa |
Gene Name | autophagy related 9A |
Database Link | |
Background | ATG9A belongs to the ATG9 family. It plays a role in autophagy. |
Synonyms | APG9L1; mATG9; MGD3208 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 77% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review