ASH2L Rabbit Polyclonal Antibody

CAT#: TA335738

Rabbit Polyclonal Anti-ASH2L Antibody

Product Images

WB Suggested Anti-ASH2L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

• 

  Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ASH2L antibody

• 

  Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ASH2L antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the middle region of human ASH2L. Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: ASH2 like histone lysine methyltransferase complex subunit
• Database Link:
  NP_004665
  Entrez Gene 9070 Human
  UniProt ID Q9UBL3
• Background: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. The protein may function as a transcriptional regulator and play a role in hematopoiesis.
• Synonyms: ASH2; ASH2L1; ASH2L2; Bre2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors