TBL2 Rabbit Polyclonal Antibody

CAT#: TA335650

Rabbit Polyclonal Anti-TBL2 Antibody

Product Images

WB Suggested Anti-TBL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBL2 Antibody: synthetic peptide directed towards the N terminal of human TBL2. Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: transducin (beta)-like 2
• Database Link:
  NP_036585
  Entrez Gene 26608 Human
  UniProt ID Q9Y4P3
• Background: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
• Synonyms: WBSCR13; WS-betaTRP
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Rabbit: 86%; Mouse: 85%

Reference Data

• Protein Families: Transmembrane