CCR4 NOT transcription complex subunit 3 (CNOT3) Rabbit Polyclonal Antibody

CAT#: TA335620

Rabbit Polyclonal Anti-CNOT3 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of CCR4-NOT transcription complex, subunit 3 (CNOT3)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human CCR4-NOT transcription complex, subunit 3 (CNOT3), 20 µg
    • 20 ug

USD 867.00

Other products for "CCR4 NOT transcription complex subunit 3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CNOT3 Antibody: synthetic peptide directed towards the N terminal of human CNOT3. Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 67 kDa
Gene Name CCR4-NOT transcription complex subunit 3
Background CNOT3 is a protein component of CCR4-NOT protein complex. Yeast CCR$-NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.
Synonyms LENG2; NOT3; NOT3H
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transcription Factors
Protein Pathways RNA degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.