TTC12 Rabbit Polyclonal Antibody

CAT#: TA335532

Rabbit Polyclonal Anti-TTC12 Antibody

Product Images

WB Suggested Anti-TTC12 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTC12 Antibody: synthetic peptide directed towards the C terminal of human TTC12. Synthetic peptide located within the following region: MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: tetratricopeptide repeat domain 12
• Database Link:
  NP_060338
  Entrez Gene 54970 Human
  UniProt ID Q9H892
• Background: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
• Synonyms: TPARM
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%