ARMCX6 Rabbit Polyclonal Antibody

CAT#: TA335507

Rabbit Polyclonal Anti-ARMCX6 Antibody

Product Images

WB Suggested Anti-ARMCX6 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARMCX6 Antibody: synthetic peptide directed towards the N terminal of human ARMCX6. Synthetic peptide located within the following region: TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: armadillo repeat containing, X-linked 6
• Database Link:
  NP_061880
  Entrez Gene 54470 Human
  UniProt ID Q7L4S7
• Background: The function remains unknown.
• Synonyms: GASP10
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 86%; Dog: 79%

Reference Data

• Protein Families: Transmembrane