Lin28 (LIN28A) Rabbit Polyclonal Antibody

CAT#: TA335465

Rabbit Polyclonal Anti-LIN28 Antibody

Product Images

WB Suggested Anti-LIN28 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

• 

  Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-LIN28 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LIN28 Antibody: synthetic peptide directed towards the N terminal of human LIN28. Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: lin-28 homolog A
• Database Link:
  NP_078950
  Entrez Gene 79727 Human
  UniProt ID Q9H9Z2
• Background: LIN28 acts as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. The association of LIN28 with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. IT binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. LIN28 is Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression.
• Synonyms: CSDD1; LIN-28; lin-28A; LIN28; ZCCHC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Goat: 91%; Mouse: 90%; Guinea pig: 86%; Yeast: 77%

Reference Data

• Protein Families: Transcription Factors