FAM130A1 (CSRNP2) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of cysteine-serine-rich nuclear protein 2 (CSRNP2)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "FAM130A1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CSRNP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CSRNP2. Synthetic peptide located within the following region: PAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 59 kDa |
Gene Name | cysteine and serine rich nuclear protein 2 |
Database Link | |
Background | The protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene. |
Synonyms | C12orf2; C12orf22; FAM130A1; PPP1R72; TAIP-12 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rat: 86%; Dog: 85%; Bovine: 85%; Rabbit: 79%; Sheep: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.