ANKRD13D Rabbit Polyclonal Antibody

CAT#: TA335105

Rabbit polyclonal Anti-Ankrd13d Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of ankyrin repeat domain 13 family, member D (ANKRD13D), transcript variant 1
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ANKRD13D"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Ankrd13d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name ankyrin repeat domain 13 family member D
Background The function remains unknown.
Synonyms MGC50828
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 92%; Mouse: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.