CFHL2 (CFHR2) Rabbit Polyclonal Antibody

CAT#: TA335100

Rabbit Polyclonal Anti-CFHR2 Antibody

Product Images

Host: Rabbit; Target Name: CFHR2; Sample Tissue: OVCAR-3 Whole cell lysates; Antibody Dilution: 1.0 ug/ml; CFHR2 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CFHR2 antibody is: synthetic peptide directed towards the C-terminal region of Human CFHR2. Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: complement factor H related 2
• Database Link:
  NP_005657
  Entrez Gene 3080 Human
  UniProt ID P36980
• Background: CFHR2 might be involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.
• Synonyms: CFHL2; FHR2; HFL3
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 82%

Reference Data

• Protein Families: Secreted Protein