EPS8 Rabbit Polyclonal Antibody

CAT#: TA335075

Rabbit Polyclonal Anti-EPS8 Antibody

Product Images

WB Suggested Anti-EPS8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: ACHN cell lysateEPS8 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPS8 antibody: synthetic peptide directed towards the middle region of human EPS8. Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: epidermal growth factor receptor pathway substrate 8
• Database Link:
  NP_004438
  Entrez Gene 2059 Human
  UniProt ID Q12929
• Background: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
• Synonyms: DFNB102
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome