Gamma taxilin (TXLNG) Rabbit Polyclonal Antibody

CAT#: TA334922

Rabbit Polyclonal Anti-TXLNG Antibody

Product Images

Host: Rabbit; Target Name: TXLNG; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TXLNG antibody is: synthetic peptide directed towards the N-terminal region of Human TXLNG. Synthetic peptide located within the following region: KADMLCNSQSNDILQHQGSNCGGTSNKHSLEEDEGSDFITENRNLVSPAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: taxilin gamma
• Database Link:
  NP_060830
  Entrez Gene 55787 Human
  UniProt ID Q9NUQ3
• Background: This gene encodes a member of the taxilin family. The encoded protein binds to the C-terminal coiled-coil region of syntaxin family members 1A, 3A and 4A, and may play a role in intracellular vesicle trafficking. This gene is up-regulated by lipopolysaccharide and the gene product may be involved in cell cycle regulation. The related mouse protein was also shown to inhibit activating transcription factor 4-mediated transcription and thus regulate bone mass accrual. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CXorf15; ELRG; FIAT; LSR5; TXLNGX
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Rabbit: 86%; Bovine: 85%; Horse: 79%; Pig: 77%; Mouse: 75%