C8orf82 Rabbit Polyclonal Antibody

CAT#: TA334919

Rabbit Polyclonal Anti-C8orf82 Antibody

Product Images

Host: Rabbit; Target Name: C8orf82; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C8orf82 antibody is synthetic peptide directed towards the N-terminal region of Human C8orf82. Synthetic peptide located within the following region: TLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: chromosome 8 open reading frame 82
• Database Link:
  NP_001001795
  Entrez Gene 414919 Human
  UniProt ID Q6P1X6
• Background: The function of this protein remains unknown.
• Synonyms: MGC70857
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%; Dog: 85%