KIAA1751 (CFAP74) Rabbit Polyclonal Antibody

CAT#: TA334857

Rabbit Polyclonal Anti-C1orf222 Antibody

Product Images

Host: Rabbit; Target Name: C1orf222; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf222 antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf222. Synthetic peptide located within the following region: EELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKKTVEFSIDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: cilia and flagella associated protein 74
• Database Link:
  NP_001003808
  Entrez Gene 339457 Entrez Gene 85452 Human
  UniProt ID Q9C0B2
• Background: The function of this protein remains unknown.
• Synonyms: MGC133181
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 90%; Dog: 86%; Bovine: 86%