Rhotekin 2 (RTKN2) Rabbit Polyclonal Antibody

CAT#: TA334812

Rabbit Polyclonal Anti-RTKN2 Antibody

Product Images

Host: Rabbit; Target Name: RTKN2; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RTKN2 antibody is: synthetic peptide directed towards the N-terminal region of Human RTKN2. Synthetic peptide located within the following region: DIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: rhotekin 2
• Database Link:
  NP_660350
  Entrez Gene 219790 Human
  UniProt ID Q8IZC4
• Background: RTKN2 may play an important role in lymphopoiesis.
• Synonyms: bA531F24.1; PLEKHK1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 92%