KIF5B Rabbit Polyclonal Antibody

CAT#: TA334689

Rabbit Polyclonal Anti-KIF5B Antibody

Product Images

WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the N terminal of human KIF5B. Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: kinesin family member 5B
• Database Link:
  NP_004512
  Entrez Gene 3799 Human
  UniProt ID P33176
• Background: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
• Synonyms: HEL-S-61; KINH; KNS; KNS1; UKHC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome