PTPN22 Rabbit Polyclonal Antibody

CAT#: TA334457

Rabbit Polyclonal Anti-PTPN22 Antibody

Product Images

Host: Rabbit; Target Name: PTPN22; Sample Tissue: Thyroid Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: protein tyrosine phosphatase, non-receptor type 22
• Database Link:
  NP_001180360
  Entrez Gene 26191 Human
  UniProt ID Q9Y2R2
• Background: The function of this protein remains unknown.
• Synonyms: LYP; LYP1; LYP2; PEP; PTPN8
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Yeast: 82%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase