PPEF2 Rabbit Polyclonal Antibody

CAT#: TA334351

Reviews ()
Write a review

Rabbit Polyclonal Anti-PPEF2 Antibody

 Product Datasheet for 'TA334351'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PPEF2 antibody is: synthetic peptide directed towards the C-terminal region of Human PPEF2. Synthetic peptide located within the following region: LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 83 kDa
Gene Name protein phosphatase with EF-hand domain 2
Background This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein, which is expressed specifically in photoreceptors and the pineal, has been suggested to play a role in the visual system. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene.
Synonyms PPP7CB
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome
Other products for "PPEF2"
Frequently bought together (2)
Transient overexpression lysate of protein phosphatase, EF-hand calcium binding domain 2 (PPEF2)
    • 100 ug

USD 495.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones