CRSP8 (MED27) Rabbit Polyclonal Antibody

CAT#: TA334249

Rabbit Polyclonal Anti-MED27 Antibody

Product Images

WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: MED27; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml; MED27 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: MED27; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; MED27 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: MED27; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; MED27 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: MED27; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; MED27 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MED27 antibody: synthetic peptide directed towards the middle region of human MED27. Synthetic peptide located within the following region: LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: mediator complex subunit 27
• Database Link:
  NP_004260
  Entrez Gene 9442 Human
  UniProt ID Q6P2C8
• Background: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED27 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
• Synonyms: CRAP34; CRSP8; CRSP34; MED3; TRAP37
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%; Dog: 85%; Rabbit: 85%