ZNF436 Rabbit Polyclonal Antibody

CAT#: TA334213

Rabbit Polyclonal Anti-ZNF436 Antibody

Product Images

WB Suggested Anti-ZNF436 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF436 antibody: synthetic peptide directed towards the N terminal of human ZNF436. Synthetic peptide located within the following region: RQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHCGKAFSQISDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger protein 436
• Database Link:
  NP_085137
  Entrez Gene 80818 Human
  UniProt ID Q9C0F3
• Background: ZNF436 is a candidate transcription factor
• Synonyms: Zfp46; ZNF
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transcription Factors