LIPK Rabbit Polyclonal Antibody

CAT#: TA334116

Rabbit Polyclonal Anti-LIPK Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of lipase, family member K (LIPK)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "LIPK"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LIPK Antibody is: synthetic peptide directed towards the N-terminal region of Human LIPK. Synthetic peptide located within the following region: LLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name lipase family member K
Background LIPK plays a highly specific role in the last step of keratinocyte differentiation. It may have an essential function in lipid metabolism of the most differentiated epidermal layers.
Synonyms bA186O14.2; LIPL2
Note Immunogen sequence homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.