ELP4 Rabbit Polyclonal Antibody

CAT#: TA334063

Rabbit Polyclonal Anti-ELP4 Antibody

Product Images

Host: Rabbit; Target Name: ELP4; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ELP4 Antibody is: synthetic peptide directed towards the C-terminal region of Human ELP4. Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: elongator acetyltransferase complex subunit 4
• Database Link:
  NP_001275654
  Entrez Gene 26610 Human
  UniProt ID Q96EB1
• Background: This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
• Synonyms: AN; C11orf19; dJ68P15A.1; hELP4; PAX6NEB; PAXNEB
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Horse: 86%