TFIISH (TCEA3) Rabbit Polyclonal Antibody

CAT#: TA334026

Rabbit Polyclonal Anti-TCEA3 Antibody

Product Images

WB Suggested Anti-TCEA3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TCEA3 Antibody: synthetic peptide directed towards the middle region of human TCEA3. Synthetic peptide located within the following region: KSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: transcription elongation factor A3
• Database Link:
  NP_003187
  Entrez Gene 6920 Human
  UniProt ID O75764
• Background: Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TCEA3 with an internal ID of P04456
• Synonyms: TFIIS; TFIIS.H
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Guinea pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors