EBP50 (SLC9A3R1) Rabbit Polyclonal Antibody

CAT#: TA333974

Rabbit Polyclonal Anti-SLC9A3R1 Antibody

Product Images

Host: Rabbit; Target Name: SLC9A3R1; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC9A3R1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC9A3R1. Synthetic peptide located within the following region: RSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: SLC9A3 regulator 1
• Database Link:
  NP_004243
  Entrez Gene 9368 Human
  UniProt ID O14745
• Background: This gene encodes a sodium/hydrogen exchanger regulatory cofactor. The protein interacts with and regulates various proteins including the cystic fibrosis transmembrane conductance regulator and G-protein coupled receptors such as the beta2-adrenergic receptor and the parathyroid hormone 1 receptor. The protein also interacts with proteins that function as linkers between integral membrane and cytoskeletal proteins. The protein localizes to actin-rich structures including membrane ruffles, microvilli, and filopodia. Mutations in this gene result in hypophosphatemic nephrolithiasis/osteoporosis type 2, and loss of heterozygosity of this gene is implicated in breast cancer.
• Synonyms: EBP50; NHERF; NHERF-1; NHERF1; NPHLOP2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome