SLC22A14 Rabbit Polyclonal Antibody

CAT#: TA333959

Rabbit Polyclonal Anti-SLC22A14 Antibody

Product Images

Host: Rabbit; Target Name: SLC22A14; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A14 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC22A14. Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: solute carrier family 22 member 14
• Database Link:
  NP_004794
  Entrez Gene 9389 Human
  UniProt ID Q9Y267
• Background: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.
• Synonyms: OCTL2; OCTL4; ORCTL4
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Dog: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane