YL1 (VPS72) Rabbit Polyclonal Antibody

CAT#: TA333926

Rabbit Polyclonal Anti-VPS72 Antibody

Product Images

WB Suggested Anti-VPS72 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VPS72 Antibody: synthetic peptide directed towards the N terminal of human VPS72. Synthetic peptide located within the following region: GGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEEPRRKRRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: vacuolar protein sorting 72 homolog
• Database Link:
  NP_005988
  Entrez Gene 6944 Human
  UniProt ID Q15906
• Background: VPS72 could be a DNA-binding transcriptional regulator. VPS72 may be involved in chromatin modification and remodeling.
• Synonyms: CFL1; Swc2; TCFL1; YL-1; YL1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors