FTSJD2 (CMTR1) Rabbit Polyclonal Antibody

CAT#: TA333851

Rabbit Polyclonal Anti-CMTR1 Antibody

Product Images

Host: Rabbit; Target Name: FTSJD2; Sample Tissue: ACHN Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CMTR1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CMTR1. Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: cap methyltransferase 1
• Database Link:
  NP_055865
  Entrez Gene 23070 Human
  UniProt ID Q8N1G2
• Background: CMTR1 is a S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. It methylates the ribose of the first nucleotide of a m7GpppG-capped mRNA to produce m7GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. It may be involved in the interferon response pathway.
• Synonyms: FTSJD2; hMTr1; KIAA0082; MTr1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%