Syntenin 2 (SDCBP2) Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 436.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SDCBP2 Antibody: synthetic peptide directed towards the N terminal of human SDCBP2. Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 23 kDa |
Gene Name | syndecan binding protein 2 |
Database Link | |
Background | SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown. |
Synonyms | SITAC; SITAC18; ST-2 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Bovine: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review